RUNX2 Antikörper (Middle Region)

Produktnummer ABIN629583

Produktdetails anti-RUNX2 Antikörper

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RUNX2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RUNX2 antibody was raised against the middle region of RUNX2

Aufreinigung: Purified

Immunogen: RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RUNX2 Blocking Peptide, catalog no. 33R-2188, is also available for use as a blocking control in assays to test for specificity of this RUNX2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUNX2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RUNX2

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Andere Bezeichnung: RUNX2 (RUNX2 Produkte)

Synonyme: AML3 antikoerper, CBF-alpha-1 antikoerper, CBFA1 antikoerper, CCD antikoerper, CCD1 antikoerper, CLCD antikoerper, OSF-2 antikoerper, OSF2 antikoerper, PEA2aA antikoerper, PEBP2aA antikoerper, Cbf antikoerper, Cbfa-1 antikoerper, Cbfa1 antikoerper, LS3 antikoerper, Osf2 antikoerper, Pebp2a1 antikoerper, Pebpa2a antikoerper, runx2 antikoerper, RUNX2 antikoerper, ccd antikoerper, aml3 antikoerper, ccd1 antikoerper, osf2 antikoerper, cbfa1 antikoerper, pea2aa antikoerper, pebp2a1 antikoerper, pebp2a2 antikoerper, pebp2aa antikoerper, pebp2aa1 antikoerper, runt related transcription factor 2 antikoerper, runt-related transcription factor 2a antikoerper, runt-related transcription factor 2 antikoerper, runt related transcription factor 2 L homeolog antikoerper, RUNX2 antikoerper, runx2a antikoerper, Runx2 antikoerper, runx2 antikoerper, LOC703331 antikoerper, LOC100549663 antikoerper, runx2.L antikoerper

Hintergrund: RUNX2 is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants, encoding different protein isoforms, result from alternate promoter use as well as alternate splicing.

Molekulargewicht: 57 kDa (MW of target protein)