RUNX2 Antikörper (Middle Region)

Produktnummer ABIN629583

Dieses Anti-RUNX2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RUNX2 in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für RUNX2 Antikörper (Middle Region) (ABIN629583)

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RUNX2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RUNX2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RUNX2 antibody was raised against the middle region of RUNX2

Aufreinigung: Purified

Immunogen: RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RUNX2 Blocking Peptide, (ABIN937574), is also available for use as a blocking control in assays to test for specificity of this RUNX2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUNX2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RUNX2

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Andere Bezeichnung: RUNX2

Hintergrund: RUNX2 is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants, encoding different protein isoforms, result from alternate promoter use as well as alternate splicing.

Molekulargewicht: 57 kDa (MW of target protein)