SIRT5 Antikörper (C-Term)

Produktnummer ABIN629582

Der Kaninchen Polyklonal anti-SIRT5 Antikörper wird verwendet zum Nachweis von SIRT5 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für SIRT5 Antikörper (C-Term) (ABIN629582)

Target: SIRT5 (Sirtuin 5 (SIRT5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIRT5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SIRT5 Antikörper

Bindungsspezifität: C-Term

Spezifität: SIRT5 antibody was raised against the C terminal of SIRT5

Aufreinigung: Purified

Immunogen: SIRT5 antibody was raised using the C terminal of SIRT5 corresponding to a region with amino acids HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIRT5 Blocking Peptide, (ABIN939084), is also available for use as a blocking control in assays to test for specificity of this SIRT5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIRT5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIRT5

Target: SIRT5 (Sirtuin 5 (SIRT5))

Andere Bezeichnung: SIRT5

Hintergrund: SIRT5 is included in class III of the sirtuin family which ischaracterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom