RORA Antikörper (Middle Region)

Produktnummer ABIN629579

Der Kaninchen Polyklonal Anti-RORA-Antikörper wurde für WB und IHC validiert. Er ist geeignet, RORA in Proben von Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio) zu detektieren.

Kurzübersicht für RORA Antikörper (Middle Region) (ABIN629579)

Target: RORA (RAR-Related Orphan Receptor A (RORA))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RORA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RORA Antikörper

Bindungsspezifität: Middle Region

Spezifität: RORA antibody was raised against the middle region of RORA

Aufreinigung: Purified

Immunogen: RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RORA Blocking Peptide, (ABIN938702), is also available for use as a blocking control in assays to test for specificity of this RORA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RORA

Target: RORA (RAR-Related Orphan Receptor A (RORA))

Andere Bezeichnung: RORA

Hintergrund: The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha