RORA Antikörper (N-Term)

Produktnummer ABIN629574

Dieses Anti-RORA-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RORA in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für RORA Antikörper (N-Term) (ABIN629574)

Target: RORA (RAR-Related Orphan Receptor A (RORA))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RORA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RORA Antikörper

Bindungsspezifität: N-Term

Spezifität: RORA antibody was raised against the N terminal of RORA

Aufreinigung: Purified

Immunogen: RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RORA Blocking Peptide, (ABIN937078), is also available for use as a blocking control in assays to test for specificity of this RORA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RORA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RORA

Target: RORA (RAR-Related Orphan Receptor A (RORA))

Andere Bezeichnung: RORA

Hintergrund: The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha