CEP68 Antikörper

Produktnummer ABIN5708411

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CEP68 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für CEP68 Antikörper (ABIN5708411)

Target: CEP68 (Centrosomal Protein 68kDa (CEP68))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CEP68 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CEP68 Antikörper

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID were used as the immunogen for the CEP68 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CEP68 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the CEP68 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CEP68

Target: CEP68 (Centrosomal Protein 68kDa (CEP68))

Andere Bezeichnung: CEP68

Hintergrund: Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and Rootletin depend both on each other for centriole association, and both also require CEP250 for their function.

UniProt: Q76N32

Pathways: SARS-CoV-2 Protein Interaktom