CPA Antikörper

Produktnummer ABIN5708326

Dieses Anti-CPA-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CPA in WB. Geeignet für Maus und Ratte.

Kurzübersicht für CPA Antikörper (ABIN5708326)

Target: CPA (Carboxypeptidase A (CPA))

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CPA Antikörper

Kreuzreaktivität (Details): Expected species reactivity: Human

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD from the human protein were used as the immunogen for the Carboxypeptidase A antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Carboxypeptidase A antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Carboxypeptidase A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CPA

Target: CPA (Carboxypeptidase A (CPA))

Andere Bezeichnung: Carboxypeptidase A

Hintergrund: Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer.

UniProt: P15085