SP6 Antikörper

Produktnummer ABIN5708284

Dieses Anti-SP6-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SP6 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für SP6 Antikörper (ABIN5708284)

Target: SP6 (Sp6 Transcription Factor (SP6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SP6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SP6 Antikörper

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH from the human protein were used as the immunogen for the SP6 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the SP6 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the SP6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu SP6

Target: SP6 (Sp6 Transcription Factor (SP6))

Andere Bezeichnung: SP6 / Transcription factor Sp6

Hintergrund: SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes. By somatic cell hybrid analysis and FISH, he SP6 gene is mapped t to chromosome 17q21.3-q22.

UniProt: Q3SY56