PML Antikörper (AA 140-177)

Produktnummer ABIN5708267

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PML in WB und IHC (p). Es zeigt Reaktivität gegenüber Proben von Maus.

Kurzübersicht für PML Antikörper (AA 140-177) (ABIN5708267)

Target: PML (Promyelocytic Leukemia (PML))

Reaktivität: Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PML Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-PML Antikörper

Bindungsspezifität: AA 140-177

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 140-177 (LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN) from the mouse protein were used as the immunogen for the PML antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the PML antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu PML

Target: PML (Promyelocytic Leukemia (PML))

Andere Bezeichnung: PML / Promyelocytic leukemia protein

Hintergrund: Promyelocytic leukemia protein functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms.

UniProt: Q60953

Pathways: p53 Signalweg, Retinoic Acid Receptor Signaling Pathway, Maintenance of Protein Location, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus