PML Antikörper (AA 141-179)

Produktnummer ABIN5708266

Dieses Anti-PML-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PML in WB und IHC (p). Geeignet für Human, Maus und Ratte.

Kurzübersicht für PML Antikörper (AA 141-179) (ABIN5708266)

Target: PML (Promyelocytic Leukemia (PML))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PML Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-PML Antikörper

Bindungsspezifität: AA 141-179

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 141-179 (FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD) from the human protein were used as the immunogen for the PML antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the PML antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu PML

Target: PML (Promyelocytic Leukemia (PML))

Andere Bezeichnung: PML / Promyelocytic leukemia protein

Hintergrund: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions, all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.

UniProt: P29590

Pathways: p53 Signalweg, Retinoic Acid Receptor Signaling Pathway, Maintenance of Protein Location, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus