NFIB Antikörper

Produktnummer ABIN5708262

Der Kaninchen Polyklonal anti-NFIB Antikörper wird verwendet zum Nachweis von NFIB in Proben von Human, Maus und Ratte. Er wurde validiert für WB und IHC (p).

Kurzübersicht für NFIB Antikörper (ABIN5708262)

Target: NFIB (Nuclear Factor I/B (NFIB))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NFIB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-NFIB Antikörper

Verwendungszweck: NFIB Antibody / Nuclear factor 1 B-type

Sequenz: ELVRVSRTPI TQGTGVNFPI GEIPSQPYYH DMNSGVNLQR

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR were used as the immunogen for the NFIB antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the NFIB antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the NFIB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu NFIB

Target: NFIB (Nuclear Factor I/B (NFIB))

Andere Bezeichnung: NFIB

Hintergrund: Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [UniProt]

UniProt: O00712