TCP1 alpha/CCTA Antikörper (C-Term)

Produktnummer ABIN5693078

Produktdetails anti-TCP1 alpha/CCTA Antikörper

Target: TCP1 alpha/CCTA (TCP1) (T-Complex 1 (TCP1))

Bindungsspezifität: AA 515-551, C-Term

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser TCP1 alpha/CCTA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Marke: Picoband™

Sequenz: KFATEAAITI LRIDDLIKLH PESKDDKHGS YEDAVHS

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Mouse IgG monoclonal antibody for TCP1 alpha detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Klon: 2E7

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
Immunohistochemistry(Frozen Section), 0.5-1 μg/mL
Immunocytochemistry, 0.5-1 μg/mL
Flow Cytometry, 1-3 μg/1x10⁶ cells

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-TCP1 alpha/CCTA Antikörper (ABIN5693078)

Gong, Guo, Huang, Sun: "Inhaled nitric oxide alleviates hyperoxia suppressed phosphatidylcholine synthesis in endotoxin-induced injury in mature rat lungs." in: Respiratory research, Vol. 7, pp. 5, (2006) (PubMed).

Details zu TCP1 alpha/CCTA

Target: TCP1 alpha/CCTA (TCP1) (T-Complex 1 (TCP1))

Andere Bezeichnung: TCP1 (TCP1 Produkte)

Synonyme: CCT-alpha antikoerper, CCT1 antikoerper, CCTa antikoerper, D6S230E antikoerper, TCP-1-alpha antikoerper, AI528772 antikoerper, CCT antikoerper, Cct1 antikoerper, Ccta antikoerper, TRic antikoerper, Tcp-1 antikoerper, Tp63 antikoerper, c-cpn antikoerper, p63 antikoerper, TRiC antikoerper, CCTalpha antikoerper, BEST:GH05123 antikoerper, CG5374 antikoerper, Dmel\\CG5374 antikoerper, T-cpl antikoerper, TCP-1alpha antikoerper, TCPA_DROME antikoerper, Tcp1 antikoerper, Tcp1-alpha antikoerper, gh05123 antikoerper, cct-alpha antikoerper, ccta antikoerper, tcp1 antikoerper, tcp1-a antikoerper, tcp1a antikoerper, tcp1alpha antikoerper, CHUNP6875 antikoerper, fa13h08 antikoerper, wu:fa13h08 antikoerper, wu:fc95g06 antikoerper, t-complex 1 antikoerper, T-complex protein 1 subunit alpha antikoerper, t-complex protein 1 antikoerper, Tcp1-like antikoerper, t-complex 1 S homeolog antikoerper, TCP1 antikoerper, cct-1 antikoerper, Tcp1 antikoerper, T-cp1 antikoerper, tcp1.S antikoerper, tcp1 antikoerper

Hintergrund:

Synonyms: T-complex protein 1 subunit alpha, TCP-1-alpha, CCT-alpha, TCP1, CCT1, CCTA

Background: T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.

UniProt: P17987