Cytokeratin 19 Antikörper (C-Term)
-
- Target Alle Cytokeratin 19 (KRT19) Antikörper anzeigen
- Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))
-
Bindungsspezifität
- AA 334-372, C-Term
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser Cytokeratin 19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Marke
- Picoband™
- Sequenz
- QLAHIQALIS GIEAQLGDVR ADSERQNQEY QRLMDIKSR
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
- Mouse IgG monoclonal antibody for Cytokeratin 19 detection. Tested with WB, IHC-P in Human.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
- Klon
- 3D4
- Isotyp
- IgG1
- Top Product
- Discover our top product KRT19 Primärantikörper
-
-
- Applikationshinweise
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
-
Establishment and evaluation of the goose embryo epithelial (GEE) cell line as a new model for propagation of avian viruses." in: PLoS ONE, Vol. 13, Issue 3, pp. e0193876, (2018) (PubMed).
: "Utilization of E-cadherin by monocytes from tumour cells plays key roles in the progression of bone invasion by oral squamous cell carcinoma." in: Oncology reports, Vol. 38, Issue 2, pp. 850-858, (2017) (PubMed).
: "Tropism of liver epithelial cells toward hepatocellular carcinoma in vitro and in vivo with altering gene expression of cancer stem cells." in: American journal of surgery, Vol. 215, Issue 4, pp. 735-743, (2017) (PubMed).
: "Stem cell-like circulating tumor cells indicate poor prognosis in gastric cancer." in: BioMed research international, Vol. 2014, pp. 981261, (2015) (PubMed).
: "Adult islets cultured in collagen gel transdifferentiate into duct-like cells." in: World journal of gastroenterology, Vol. 11, Issue 22, pp. 3426-30, (2005) (PubMed).
: "
-
Establishment and evaluation of the goose embryo epithelial (GEE) cell line as a new model for propagation of avian viruses." in: PLoS ONE, Vol. 13, Issue 3, pp. e0193876, (2018) (PubMed).
-
- Target
- Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))
- Andere Bezeichnung
- KRT19 (KRT19 Produkte)
- Synonyme
- CK19 antikoerper, K19 antikoerper, K1CS antikoerper, AI663979 antikoerper, EndoC antikoerper, Krt-1.19 antikoerper, Krt1-19 antikoerper, Ka19 antikoerper, k19 antikoerper, ck19 antikoerper, k1cs antikoerper, krt9 antikoerper, krt15 antikoerper, MGC76282 antikoerper, GK-19 antikoerper, MGC83069 antikoerper, KRT19 antikoerper, keratin 19 antikoerper, keratin 19 L homeolog antikoerper, keratin, type I cytoskeletal 19 antikoerper, KRT19 antikoerper, Krt19 antikoerper, krt19 antikoerper, krt19.L antikoerper, LOC100344434 antikoerper, LOC101117946 antikoerper
- Hintergrund
-
Synonyms: Keratin, type I cytoskeletal 19, Cytokeratin-19, CK-19, Keratin-19, K19, KRT19
Tissue Specificity: Expressed in a defined zone of basal keratinocytes in the deep outer root sheath of hair follicles. Also observed in sweat gland and mammary gland ductal and secretory cells, bile ducts, gastrointestinal tract, bladder urothelium, oral epithelia, esophagus, ectocervical epithelium (at protein level). Expressed in epidermal basal cells, in nipple epidermis and a defined region of the hair follicle. Also seen in a subset of vascular wall cells in both the veins and artery of human umbilical cord, and in umbilical cord vascular smooth muscle. Observed in muscle fibers accumulating in the costameres of myoplasm at the sarcolemma in structures that contain dystrophin and spectrin.
Background: Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.
- UniProt
- P08727
-