SP6 Antikörper

Produktnummer ABIN5692945

Produktdetails anti-SP6 Antikörper

Target: SP6 (Sp6 Transcription Factor (SP6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SP6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Marke: Picoband™

Sequenz: QPDMSHHYES WFRPTHPGAE DGSWWDLHPG TSWMDLPH

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for SP6 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human SP6 (QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu SP6

Target: SP6 (Sp6 Transcription Factor (SP6))

Andere Bezeichnung: SP6 (SP6 Produkte)

Synonyme: xsp6 antikoerper, MGC131081 antikoerper, EPFN antikoerper, EPIPROFIN antikoerper, KLF14 antikoerper, 1110025J03Rik antikoerper, AA591031 antikoerper, AI592962 antikoerper, Epfn antikoerper, Klf14 antikoerper, Sp6 transcription factor antikoerper, Sp5 transcription factor L homeolog antikoerper, trans-acting transcription factor 6 antikoerper, SP6 antikoerper, sp5.L antikoerper, Sp6 antikoerper

Hintergrund:

Synonyms: Transcription factor Sp6, Krueppel-like factor 14, SP6, KLF14

Tissue Specificity: Ubiquitous.

Background: SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes. By somatic cell hybrid analysis and FISH, he SP6 gene is mapped t to chromosome 17q21.3-q22.