Emerin Antikörper (N-Term)

Produktnummer ABIN5692852

Produktdetails anti-Emerin Antikörper

Target: Emerin (EMD)

Bindungsspezifität: AA 1-48, N-Term

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser Emerin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Marke: Picoband™

Sequenz: MDNYADLSDT ELTTLLRRYN IPHGPVVGST RRLYEKKIFE YETQRRRL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Mouse IgG monoclonal antibody for Emerin detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino ac

Klon: 5A10

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
Immunohistochemistry(Frozen Section), 0.5-1 μg/mL
Immunocytochemistry, 0.5-1 μg/mL
Flow Cytometry, 1-3 μg/1x10⁶ cells

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu Emerin

Target: Emerin (EMD)

Andere Bezeichnung: EMD (EMD Produkte)

Synonyme: fj58f01 antikoerper, wu:fj58f01 antikoerper, EMD antikoerper, Bocks antikoerper, Bocksbeutel antikoerper, CG9424 antikoerper, Dmel\\CG9424 antikoerper, emerin antikoerper, emd antikoerper, xemd1 antikoerper, xemerin2 antikoerper, xemd2 antikoerper, xemerin1 antikoerper, EDMD antikoerper, LEMD5 antikoerper, STA antikoerper, AW550900 antikoerper, Sta antikoerper, emerin antikoerper, emerin (Emery-Dreifuss muscular dystrophy) antikoerper, bocksbeutel antikoerper, emerin L homeolog antikoerper, emerin S homeolog antikoerper, EMD antikoerper, emd antikoerper, bocks antikoerper, emd.L antikoerper, emd.S antikoerper, Emd antikoerper

Hintergrund:

Synonyms: Emerin, EMD, EDMD, STA

Tissue Specificity: Skeletal muscle, heart, colon, testis, ovary and pancreas.

UniProt: P50402