FABP5 Antikörper

Produktnummer ABIN5692847

Produktdetails anti-FABP5 Antikörper

Target: FABP5 (Fatty Acid Binding Protein 5 (Psoriasis-Associated) (FABP5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FABP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Marke: Picoband™

Sequenz: KWRLMESHGF EEYMKELGVG LALRKMAAMA KPD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for FABP5 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human FABP5 (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).

Anwendungsinformationen

Applikationshinweise:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot,0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section),0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Details zu FABP5

Target: FABP5 (Fatty Acid Binding Protein 5 (Psoriasis-Associated) (FABP5))

Andere Bezeichnung: FABP5 (FABP5 Produkte)

Synonyme: E-FABP antikoerper, EFABP antikoerper, KFABP antikoerper, PA-FABP antikoerper, PAFABP antikoerper, FABP5 antikoerper, Fabpe antikoerper, Klbp antikoerper, mal1 antikoerper, C-FABP antikoerper, DA11 antikoerper, FABP5L1 antikoerper, fatty acid binding protein 5 antikoerper, fatty acid binding protein 5, epidermal antikoerper, fatty acid binding protein 5 (psoriasis-associated) antikoerper, fatty acid binding protein 5 pseudogene 1 antikoerper, cationic amino acid transporter 3 pseudogene antikoerper, FABP5 antikoerper, Fabp5 antikoerper, FABP5P1 antikoerper, LOC609554 antikoerper

Hintergrund:

Synonyms: Fatty acid-binding protein, epidermal, Epidermal-type fatty acid-binding protein, E-FABP, Fatty acid-binding protein 5, Psoriasis-associated fatty acid-binding protein homolog, PA-FABP, FABP5

Tissue Specificity: Keratinocytes, highly expressed in psoriatic skin.

Background: FABP5, Fatty acid-binding protein, epidermal, is a protein that in humans is encoded by the FABP5 gene. This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. It is mapped to 8q21.13. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.

UniProt: Q01469