Alpha-amylase 1 Antikörper (AA 20-50)

Produktnummer ABIN5647969

Der Kaninchen Polyklonal Anti-Alpha-amylase 1-Antikörper wurde für WB und IHC (p) validiert. Er ist geeignet, Alpha-amylase 1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Alpha-amylase 1 Antikörper (AA 20-50) (ABIN5647969)

Target: Alpha-amylase 1 (AMY1) (Amylase 1, Salivary (AMY1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Alpha-amylase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-Alpha-amylase 1 Antikörper

Bindungsspezifität: AA 20-50

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 20-50 (NTQQGRTSIVHLFEWRWVDIALECERYLAPK) from the human protein were used as the immunogen for the Alpha Amylase antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Alpha Amylase antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Alpha Amylase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Alpha-amylase 1

Target: Alpha-amylase 1 (AMY1) (Amylase 1, Salivary (AMY1))

Andere Bezeichnung: Alpha Amylase 1

Hintergrund: Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.

UniProt: P04745