MMP11 Antikörper (AA 104-135)

Produktnummer ABIN5647881

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MMP11 in WB und IHC (p). Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für MMP11 Antikörper (AA 104-135) (ABIN5647881)

Target: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMP11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-MMP11 Antikörper

Bindungsspezifität: AA 104-135

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 104-135 (RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK) from the human protein were used as the immunogen for the MMP11 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MMP11 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the MMP11 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu MMP11

Target: MMP11 (Matrix Metallopeptidase 11 (Stromelysin 3) (MMP11))

Andere Bezeichnung: MMP11

Hintergrund: Stromelysin-3 (SL-3) also known as matrix metalloproteinase-11 (MMP-11) is an enzyme that in humans is encoded by the MMP11 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the enzyme encoded by this gene is activated intracellularly by furin within the constitutive secretory pathway. Also in contrast to other MMP's, this enzyme cleaves alpha 1-proteinase inhibitor but weakly degrades structural proteins of the extracellular matrix.

UniProt: P24347