MSI1 Antikörper (AA 21-54)

Produktnummer ABIN5647867

Produktdetails anti-MSI1 Antikörper

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Bindungsspezifität: AA 21-54

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MSI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 21-54 (KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD) from the human protein were used as the immunogen for the Musashi antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Musashi antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Musashi antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu MSI1

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Andere Bezeichnung: MSI1 / Musashi 1 (MSI1 Produkte)

Synonyme: CG5099 antikoerper, DMSIDNA antikoerper, Dmel\\CG5099 antikoerper, Msi antikoerper, SIDNA antikoerper, anon-EST:Liang-2.35 antikoerper, clone 2.35 antikoerper, Msi1h antikoerper, Musashi antikoerper, Musashi-1 antikoerper, Musashi1 antikoerper, XNrp-1 antikoerper, nrp-1B antikoerper, Dsim\\GD21224 antikoerper, GD21224 antikoerper, dsim_GLEANR_4982 antikoerper, msi antikoerper, musashi antikoerper, Musahi1 antikoerper, m-Msi-1 antikoerper, msi1h antikoerper, musashi antikoerper, musashi RNA binding protein 1 antikoerper, GD21224 gene product from transcript GD21224-RD antikoerper, musashi RNA-binding protein 1 antikoerper, musashi RNA binding protein 1 S homeolog antikoerper, msi antikoerper, msi1 antikoerper, Dsim\msi antikoerper, MSI1 antikoerper, Msi1 antikoerper, msi1.S antikoerper

Hintergrund: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

UniProt: O43347

Pathways: Stem Cell Maintenance