MSI1 Antikörper (AA 21-54)

Produktnummer ABIN5647867

Der Kaninchen Polyklonal anti-MSI1 Antikörper wird verwendet zum Nachweis von MSI1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB, IF und IHC (p).

Kurzübersicht für MSI1 Antikörper (AA 21-54) (ABIN5647867)

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MSI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-MSI1 Antikörper

Bindungsspezifität: AA 21-54

Verwendungszweck: Musashi Antibody / MSI1

Sequenz: KMFIGGLSWQ TTQEGLREYF GQFGEVKECL VMRD

Aufreinigung: Antigen affinity

Immunogen: Amino acids 21-54 (KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD) from the human protein were used as the immunogen for the Musashi antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Musashi antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the Musashi antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu MSI1

Target: MSI1 (Musashi Homolog 1 (Drosophila) (MSI1))

Andere Bezeichnung: MSI1 / Musashi 1

Hintergrund: RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

UniProt: O43347

Pathways: Stem Cell Maintenance