SUB1 Antikörper (AA 96-127)

Produktnummer ABIN5647848

Produktdetails anti-SUB1 Antikörper

Target: SUB1 (Activated RNA Polymerase II Transcriptional Coactivator p15 (SUB1))

Bindungsspezifität: AA 96-127

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 96-127 (MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) from the human protein were used as the immunogen for the PC4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the PC4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu SUB1

Target: SUB1 (Activated RNA Polymerase II Transcriptional Coactivator p15 (SUB1))

Andere Bezeichnung: PC4 / Positive cofactor 4 (SUB1 Produkte)

Synonyme: P15 antikoerper, PC4 antikoerper, p14 antikoerper, AI842364 antikoerper, P9 antikoerper, Pc4 antikoerper, Rpo2tc1 antikoerper, SUB1 homolog, transcriptional regulator antikoerper, SUB1 homolog (S. cerevisiae) antikoerper, SUB1 antikoerper, Sub1 antikoerper

Hintergrund: Activated RNA polymerase II transcriptional coactivator p15, also known as Positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.

UniProt: P53999