ADAM28 Antikörper (AA 207-248)

Produktnummer ABIN5647843

Der Kaninchen Polyklonal anti-ADAM28 Antikörper wird verwendet zum Nachweis von ADAM28 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für ADAM28 Antikörper (AA 207-248) (ABIN5647843)

Target: ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAM28 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADAM28 Antikörper

Bindungsspezifität: AA 207-248

Verwendungszweck: ADAM28 Antibody

Sequenz: EYYLVLDNGE FKRYNENQDE IRKRVFEMAN YVNMLYKKLN TH

Aufreinigung: Antigen affinity

Immunogen: Amino acids 207-248 (EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH) from the human protein were used as the immunogen for the ADAM28 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ADAM28 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the ADAM28 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu ADAM28

Target: ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))

Andere Bezeichnung: ADAM28

Hintergrund: Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants.

UniProt: Q9UKQ2