12-Lipoxygenase Antikörper (AA 186-231)

Produktnummer ABIN5647834

Der Kaninchen Polyklonal anti-12-Lipoxygenase Antikörper wird verwendet zum Nachweis von 12-Lipoxygenase in Proben von Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für 12-Lipoxygenase Antikörper (AA 186-231) (ABIN5647834)

Target: 12-Lipoxygenase (LOX12)

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser 12-Lipoxygenase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-12-Lipoxygenase Antikörper

Bindungsspezifität: AA 186-231

Verwendungszweck: 12 Lipoxygenase Antibody / ALOX12

Sequenz: ALKRVYTLLS SWNCLEDFDQ IFWGQKSALA EKVRQCWQDD ELFSYQ

Aufreinigung: Antigen affinity

Immunogen: Amino acids 186-231 (ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ) were used as the immunogen for the 12 Lipoxygenase antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the 12 Lipoxygenase antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the 12 Lipoxygenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu 12-Lipoxygenase

Target: 12-Lipoxygenase (LOX12)

Andere Bezeichnung: 12 Lipoxygenase

Hintergrund: ALOX12 (Arachidonate 12-lipoxygenase) is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.

UniProt: P18054