12-Lipoxygenase Antikörper (AA 186-231)

Produktnummer ABIN5647834

Produktdetails anti-12-Lipoxygenase Antikörper

Target: 12-Lipoxygenase (LOX12)

Bindungsspezifität: AA 186-231

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser 12-Lipoxygenase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 186-231 (ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ) from the human protein were used as the immunogen for the 12 Lipoxygenase antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the 12 Lipoxygenase antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the 12 Lipoxygenase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu 12-Lipoxygenase

Target: 12-Lipoxygenase (LOX12)

Andere Bezeichnung: 12 Lipoxygenase (LOX12 Produkte)

Synonyme: 12-LOX antikoerper, 12S-LOX antikoerper, LOG12 antikoerper, wu:fi89d03 antikoerper, zgc:153926 antikoerper, arachidonate 12-lipoxygenase, 12S type antikoerper, zgc:152891 antikoerper, ALOX12 antikoerper, zgc:152891 antikoerper

Hintergrund: ALOX12 (Arachidonate 12-lipoxygenase) is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.

UniProt: P18054