KRIT1 Antikörper (AA 703-736)

Produktnummer ABIN5647767

Produktdetails anti-KRIT1 Antikörper

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Bindungsspezifität: AA 703-736

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRIT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 703-736 (ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS) from the human protein were used as the immunogen for the KRIT1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the KRIT1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu KRIT1

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Andere Bezeichnung: KRIT1 (KRIT1 Produkte)

Synonyme: CAM antikoerper, CCM1 antikoerper, 2010007K12Rik antikoerper, A630036P20Rik antikoerper, AA432855 antikoerper, AI450393 antikoerper, AI643869 antikoerper, BB155247 antikoerper, BB235701 antikoerper, Ccm1 antikoerper, RGD1305929 antikoerper, krit1 antikoerper, fb36f07 antikoerper, san antikoerper, santa antikoerper, wu:fb36f07 antikoerper, zgc:63585 antikoerper, KRIT1, ankyrin repeat containing antikoerper, KRIT1 antikoerper, Krit1 antikoerper, krit1 antikoerper

Hintergrund: Krev interaction trapped protein 1 is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

UniProt: O00522

Pathways: Cell RedoxHomeostasis