KRIT1 Antikörper (AA 703-736)

Produktnummer ABIN5647767

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch KRIT1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für KRIT1 Antikörper (AA 703-736) (ABIN5647767)

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KRIT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KRIT1 Antikörper

Bindungsspezifität: AA 703-736

Verwendungszweck: KRIT1 Antibody / CCM1

Sequenz: ENKMSFIVHT KQAGLVVKLL MKLNGQLMPT ERNS

Aufreinigung: Antigen affinity

Immunogen: Amino acids 703-736 (ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS) from the human protein were used as the immunogen for the KRIT1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Differences in protocols and secondary/substrate sensitivity may require the KRIT1 antibody to be titrated for optimal performance.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the KRIT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu KRIT1

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Andere Bezeichnung: KRIT1

Hintergrund: Krev interaction trapped protein 1 is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

UniProt: O00522

Pathways: Cell RedoxHomeostasis