CXCR4 Antikörper (AA 265-294)

Produktnummer ABIN5647758

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CXCR4 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CXCR4 Antikörper (AA 265-294) (ABIN5647758)

Target: CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CXCR4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CXCR4 Antikörper

Bindungsspezifität: AA 265-294

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 265-294 (ILLEIIKQGCEFENTVHKWISITEALAFFH) from the human protein were used as the immunogen for the CXCR4 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CXCR4 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the CXCR4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CXCR4

Target: CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))

Andere Bezeichnung: CXCR4

Hintergrund: CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.

UniProt: P61073

Pathways: Regulation of Cell Size, CXCR4-mediated Signaling Events