TECTA Antikörper (AA 93-134)

Produktnummer ABIN5647724

Dieses Anti-TECTA-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TECTA in WB und IHC (p). Geeignet für Human, Maus und Ratte.

Kurzübersicht für TECTA Antikörper (AA 93-134) (ABIN5647724)

Target: TECTA (Tectorin alpha (TECTA))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TECTA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-TECTA Antikörper

Bindungsspezifität: AA 93-134

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 93-134 (RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK) from human Alpha Tectorin were used as the immunogen for the TECTA antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the TECTA antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the TECTA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu TECTA

Target: TECTA (Tectorin alpha (TECTA))

Andere Bezeichnung: TECTA (Alpha Tectorin)

Hintergrund: Alpha Tectorin is a protein that in humans is encoded by the TECTA gene. The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness.

UniProt: O75443

Pathways: Sensory Perception of Sound