ADAM2 Antikörper (AA 231-274)

Produktnummer ABIN5647674

Produktdetails anti-ADAM2 Antikörper

Target: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Bindungsspezifität: AA 231-274

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 231-274 (WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK) from the human protein were used as the immunogen for the ADAM2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ADAM2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ADAM2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ADAM2

Target: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Andere Bezeichnung: ADAM2 (ADAM2 Produkte)

Synonyme: AI323749 antikoerper, Ftnb antikoerper, Ph30-beta antikoerper, CRYN1 antikoerper, CRYN2 antikoerper, CT15 antikoerper, FTNB antikoerper, PH-30b antikoerper, PH30 antikoerper, PH30-beta antikoerper, PH-30 antikoerper, a disintegrin and metallopeptidase domain 2 antikoerper, ADAM metallopeptidase domain 2 antikoerper, Adam2 antikoerper, ADAM2 antikoerper

Hintergrund: ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.

UniProt: Q99965