TNFAIP6 Antikörper (AA 46-91)

Produktnummer ABIN5647620

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TNFAIP6 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Ratte.

Kurzübersicht für TNFAIP6 Antikörper (AA 46-91) (ABIN5647620)

Target: TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNFAIP6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TNFAIP6 Antikörper

Bindungsspezifität: AA 46-91

Verwendungszweck: TSG6 Antibody

Sequenz: KYKLTYAEAK AVCEFEGGHL ATYKQLEAAR KIGFHVCAAG WMAKGR

Aufreinigung: Antigen affinity

Immunogen: Amino acids 46-91 (KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR) from the human protein were used as the immunogen for the TSG6 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the TSG6 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the TSG6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu TNFAIP6

Target: TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))

Andere Bezeichnung: TSG6

Hintergrund: Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.

UniProt: P98066