ATOH1 Antikörper (AA 1-30)

Produktnummer ABIN5647595

Der Kaninchen Polyklonal anti-ATOH1 Antikörper (ABIN5647595) detektiert spezifisch ATOH1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Ratte.

Kurzübersicht für ATOH1 Antikörper (AA 1-30) (ABIN5647595)

Target: ATOH1 (Atonal Homolog 1 (Drosophila) (ATOH1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATOH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ATOH1 Antikörper

Bindungsspezifität: AA 1-30

Verwendungszweck: ATOH1 Antibody / MATH1 (N-Terminal Region)

Sequenz: MSRLLHAEEW AEVKELGDHH RQPQPHHLPQ

Kreuzreaktivität (Details): Expected species reactivity: Human

Aufreinigung: Antigen affinity

Immunogen: Amino acids 1-30 (MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ) were used as the immunogen for the ATOH1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the ATOH1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the ATOH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu ATOH1

Target: ATOH1 (Atonal Homolog 1 (Drosophila) (ATOH1))

Andere Bezeichnung: ATOH1

Hintergrund: Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells).

UniProt: Q92858