MAK Antikörper (AA 588-623)

Produktnummer ABIN5647592

Dieses Anti-MAK-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MAK in WB. Geeignet für Human.

Kurzübersicht für MAK Antikörper (AA 588-623) (ABIN5647592)

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAK Antikörper

Bindungsspezifität: AA 588-623

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 588-623 (RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR) were used as the immunogen for the MAK antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MAK antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the MAK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu MAK

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Andere Bezeichnung: MAK / Male germ cell-associated kinase

Hintergrund: Serine/threonine-protein kinase MAK (Male germ cell-associated kinase) is an enzyme that in humans is encoded by the MAK gene. The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62.

UniProt: P20794