GPI Antikörper (AA 5-39)

Produktnummer ABIN5647569

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch GPI in WB und FACS. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für GPI Antikörper (AA 5-39) (ABIN5647569)

Target: GPI (Glucose-6-Phosphate Isomerase (GPI))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPI Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS)

Produktdetails anti-GPI Antikörper

Bindungsspezifität: AA 5-39

Verwendungszweck: GPI Antibody / Glucose-6-phosphate isomerase

Sequenz: TRDPQFQKLQ QWYREHRSEL NLRRLFDANK DRFNH

Aufreinigung: Antigen affinity

Immunogen: Amino acids 5-39 (TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH) from the human protein were used as the immunogen for the GPI antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Differences in protocols and secondary/substrate sensitivity may require the GPI antibody to be titrated for optimal performance.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the GPI antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu GPI

Target: GPI (Glucose-6-Phosphate Isomerase (GPI))

Andere Bezeichnung: GPI

Hintergrund: Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase(PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.

UniProt: P06744