Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

DC-SIGN/CD209 Antikörper

Der Kaninchen Polyklonal anti-DC-SIGN/CD209 Antikörper wird verwendet zum Nachweis von DC-SIGN/CD209 in Proben von Human, Maus und Ratte. Er wurde validiert für WB, FACS und IHC (p).
Produktnummer ABIN5647543
644,88 €
Zzgl. Versandkosten 20,00 € und MwSt
100 μg
Lieferung nach: Deutschland
Lieferung in 6 bis 8 Werktagen

Kurzübersicht für DC-SIGN/CD209 Antikörper (ABIN5647543)

Target

Alle DC-SIGN/CD209 (CD209) Antikörper anzeigen
DC-SIGN/CD209 (CD209) (CD209)

Reaktivität

  • 132
  • 27
  • 20
  • 1
  • 1
Human, Maus, Ratte

Wirt

  • 82
  • 64
  • 5
  • 1
Kaninchen

Klonalität

  • 79
  • 73
Polyklonal

Konjugat

  • 66
  • 11
  • 11
  • 8
  • 7
  • 4
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 3
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser DC-SIGN/CD209 Antikörper ist unkonjugiert

Applikation

  • 73
  • 56
  • 49
  • 35
  • 28
  • 19
  • 13
  • 8
  • 6
  • 6
  • 4
  • 3
  • 3
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Aufreinigung

    Antigen affinity purified

    Immunogen

    Amino acids MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA were used as the immunogen for the DC-SIGN antibody.

    Isotyp

    IgG
  • Applikationshinweise

    Optimal dilution of the DC-SIGN antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-3 μg/10^6 cells

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Lagerung

    -20 °C

    Informationen zur Lagerung

    After reconstitution, the DC-SIGN antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target

    DC-SIGN/CD209 (CD209) (CD209)

    Andere Bezeichnung

    DC-SIGN / CD209

    Hintergrund

    DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

    UniProt

    Q9NNX6
Sie sind hier:
Chat with us!