CRX Antikörper (AA 265-299)

Produktnummer ABIN5647525

Produktdetails anti-CRX Antikörper

Target: CRX (Cone-Rod Homeobox (CRX))

Bindungsspezifität: AA 265-299

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 265-299 (DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL) from the human protein were used as the immunogen for the CRX antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CRX antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the CRX antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CRX

Target: CRX (Cone-Rod Homeobox (CRX))

Andere Bezeichnung: CRX (Cone-rod homeobox) (CRX Produkte)

Synonyme: Xotx5 antikoerper, Xotx5b antikoerper, cord2 antikoerper, crd antikoerper, otx5 antikoerper, otx5b antikoerper, rx antikoerper, CRX antikoerper, crx antikoerper, otx5-b antikoerper, CORD2 antikoerper, CRD antikoerper, LCA7 antikoerper, OTX3 antikoerper, Crx1 antikoerper, otx5-A antikoerper, cone-rod homeobox antikoerper, cone-rod homeobox L homeolog antikoerper, cone-rod homeobox S homeolog antikoerper, crx antikoerper, CRX antikoerper, Crx antikoerper, crx.L antikoerper, crx.S antikoerper

Hintergrund: Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

UniProt: O43186