CRX Antikörper (AA 265-299)

Produktnummer ABIN5647525

Der Kaninchen Polyklonal Anti-CRX-Antikörper wurde für WB validiert. Er ist geeignet, CRX in Proben von Human zu detektieren.

Kurzübersicht für CRX Antikörper (AA 265-299) (ABIN5647525)

Target: CRX (Cone-Rod Homeobox (CRX))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CRX Antikörper

Bindungsspezifität: AA 265-299

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 265-299 (DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL) from the human protein were used as the immunogen for the CRX antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CRX antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the CRX antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CRX

Target: CRX (Cone-Rod Homeobox (CRX))

Andere Bezeichnung: CRX (Cone-rod homeobox)

Hintergrund: Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

UniProt: O43186