CCDC6 Antikörper (AA 156-198)

Produktnummer ABIN5647505

Der Kaninchen Polyklonal anti-CCDC6 Antikörper (ABIN5647505) detektiert spezifisch CCDC6 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Ratte.

Kurzübersicht für CCDC6 Antikörper (AA 156-198) (ABIN5647505)

Target: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCDC6 Antikörper

Bindungsspezifität: AA 156-198

Verwendungszweck: CCDC6 Antibody

Sequenz: KAELEQHLEQ EQEFQVNKLM KKIKKLENDT ISKQLTLEQL RRE

Aufreinigung: Antigen affinity

Immunogen: Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein were used as the immunogen for the CCDC6 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Differences in protocols and secondary/substrate sensitivity may require the CCDC6 antibody to be titrated for optimal performance.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the CCDC6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu CCDC6

Target: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Andere Bezeichnung: CCDC6

Hintergrund: Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.

UniProt: Q16204