ACCN1 Antikörper (AA 112-147)

Produktnummer ABIN5647475

Produktdetails anti-ACCN1 Antikörper

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Bindungsspezifität: AA 112-147

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACCN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ACCN1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ACCN1

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Andere Bezeichnung: ACCN1 / ASIC2 (ACCN1 Produkte)

Synonyme: ACCN antikoerper, ACCN1 antikoerper, ASIC2a antikoerper, BNC1 antikoerper, BNaC1 antikoerper, MDEG antikoerper, hBNaC1 antikoerper, ACIC2 antikoerper, Accn1 antikoerper, BNaC1a antikoerper, Mdeg antikoerper, BNC1k antikoerper, MDEG1 antikoerper, MDEG2 antikoerper, accn1 antikoerper, zASIC2 antikoerper, acid sensing ion channel subunit 2 antikoerper, acid-sensing (proton-gated) ion channel 2 antikoerper, ASIC2 antikoerper, Asic2 antikoerper, asic2 antikoerper

Hintergrund: Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.

UniProt: Q16515

Pathways: Sensory Perception of Sound