ACCN1 Antikörper (AA 112-147)

Produktnummer ABIN5647475

Dieses Anti-ACCN1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ACCN1 in WB. Geeignet für Human und Ratte.

Kurzübersicht für ACCN1 Antikörper (AA 112-147) (ABIN5647475)

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACCN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACCN1 Antikörper

Bindungsspezifität: AA 112-147

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ACCN1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ACCN1

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Andere Bezeichnung: ACCN1 / ASIC2

Hintergrund: Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.

UniProt: Q16515

Pathways: Sensory Perception of Sound