AKAP2 Antikörper (AA 813-852)

Produktnummer ABIN5647409

Produktdetails anti-AKAP2 Antikörper

Target: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Bindungsspezifität: AA 813-852

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKAP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 813-852 (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN) from the human protein were used as the immunogen for the AKAP2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the AKAP2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the AKAP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu AKAP2

Target: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Andere Bezeichnung: AKAP2 (AKAP2 Produkte)

Synonyme: AKAP-2 antikoerper, AKAPKL antikoerper, PRKA2 antikoerper, AA959716 antikoerper, AI649048 antikoerper, Akap-2 antikoerper, Akap-kl antikoerper, B230340M18Rik antikoerper, Prka2 antikoerper, akap-kl antikoerper, AKAP2 antikoerper, PALM2 antikoerper, A-kinase anchoring protein 2 antikoerper, A kinase (PRKA) anchor protein 2 antikoerper, A-kinase anchoring protein 2 L homeolog antikoerper, A-kinase anchor protein 2 antikoerper, AKAP2 antikoerper, Akap2 antikoerper, akap2.L antikoerper, akap2 antikoerper, LOC101114239 antikoerper

Hintergrund: A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.

UniProt: Q9Y2D5