AKAP2 Antikörper (AA 813-852)

Produktnummer ABIN5647409

Der Kaninchen Polyklonal anti-AKAP2 Antikörper (ABIN5647409) detektiert spezifisch AKAP2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für AKAP2 Antikörper (AA 813-852) (ABIN5647409)

Target: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AKAP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AKAP2 Antikörper

Bindungsspezifität: AA 813-852

Verwendungszweck: AKAP2 Antibody / A-kinase anchor protein 2

Sequenz: ETHKSKRRER MDDSSVLEAT RVNRRKSALA LRWEAGIYAN

Aufreinigung: Antigen affinity

Immunogen: Amino acids 813-852 (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN) from the human protein were used as the immunogen for the AKAP2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the AKAP2 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the AKAP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu AKAP2

Target: AKAP2 (A Kinase (PRKA) Anchor Protein 2 (AKAP2))

Andere Bezeichnung: AKAP2

Hintergrund: A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.

UniProt: Q9Y2D5