NOS2 Antikörper (AA 1088-1126)

Produktnummer ABIN5647389

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch NOS2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für NOS2 Antikörper (AA 1088-1126) (ABIN5647389)

Target: NOS2 (Nitric Oxide Synthase 2, Inducible (NOS2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NOS2 Antikörper

Bindungsspezifität: AA 1088-1126

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 1088-1126 (ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED) from the human protein were used as the immunogen for the iNOS antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the iNOS antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the iNOS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu NOS2

Target: NOS2 (Nitric Oxide Synthase 2, Inducible (NOS2))

Andere Bezeichnung: iNOS / NOS2

Hintergrund: Nitric oxide synthase, inducible is an enzyme that in humans is encoded by the NOS2 gene. Nitric oxide (NO) is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter, it is implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. Three different NOS isoforms have been identified which fall into two distinct types, constitutive and inducible. The inducible NOS (iNOS) isoform is expressed in a variety of cell types and tissues in response to inflammatory agents and cytokines. The human iNOS (NOS2) gene is approximately 37 kb in length and consists of 26 exons and 25 introns. NOS2-derived NO is a prerequisite for cytokine signaling and function in innate immunity.

UniProt: P35228

Pathways: Retinoic Acid Receptor Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Inositol Metabolic Process, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process