TFPI2 Antikörper (AA 70-105)

Produktnummer ABIN5647314

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TFPI2 in WB und IHC (p). Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für TFPI2 Antikörper (AA 70-105) (ABIN5647314)

Target: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TFPI2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-TFPI2 Antikörper

Bindungsspezifität: AA 70-105

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 70-105 (EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ) from the human protein were used as the immunogen for the TFPI2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the TFPI2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the TFPI2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu TFPI2

Target: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Andere Bezeichnung: TFPI2

Hintergrund: Tissue factor pathway inhibitor 2, also known as TFPI2, is a human gene which is located at 7q22. It is an important regulator of the extrinsic pathway of blood coagulation through its ability to inhibit factor Xa and factor VIIa-tissue factor activity. After a 22-residue signal peptide, the mature TFPI2 protein contains 213 amino acids with 18 cysteines and 2 canonical N-linked glycosylation sites. The purified recombinant TFPI2 strongly inhibited the amidolytic activities of trypsin and the factor VIIa-tissue factor complex. The latter inhibition was markedly enhanced in the presence of heparin. Mouse TFPI2 mRNA is highly expressed in developing mouse placenta, as in human. And there are also high transcript levels in adult mouse liver and kidney.

UniProt: P48307