SAFB Antikörper (AA 715-754)

Produktnummer ABIN5647265

Dieses Anti-SAFB-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SAFB in WB. Geeignet für Human.

Kurzübersicht für SAFB Antikörper (AA 715-754) (ABIN5647265)

Target: SAFB (Scaffold Attachment Factor B (SAFB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAFB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SAFB Antikörper

Bindungsspezifität: AA 715-754

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 715-754 (DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) from the human protein were used as the immunogen for the SAFB antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the SAFB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu SAFB

Target: SAFB (Scaffold Attachment Factor B (SAFB))

Andere Bezeichnung: SAFB / Scaffold attachment factor B1

Hintergrund: Scaffold attachment factor B, also known as SAFB, is a gene with homologs that have been studied in humans and mice. This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q15424

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway