RANBP2 Antikörper (AA 3018-3057)

Produktnummer ABIN5647220

Produktdetails anti-RANBP2 Antikörper

Target: RANBP2 (RAN Binding Protein 2 (RANBP2))

Bindungsspezifität: AA 3018-3057

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RANBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Kreuzreaktivität (Details): Expected species reactivity: Human

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 3018-3057 (EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE) were used as the immunogen for the RanBP2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the RanBP2 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the RanBP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu RANBP2

Target: RANBP2 (RAN Binding Protein 2 (RANBP2))

Andere Bezeichnung: RanBP2 (RANBP2 Produkte)

Hintergrund: RAN binding protein 2 (RANBP2), also called NUP358 is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. And the encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q.

UniProt: P49792

Pathways: Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus