NFIA Antikörper (AA 180-224)

Produktnummer ABIN5647218

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch NFIA in WB, FACS und IHC (p). Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für NFIA Antikörper (AA 180-224) (ABIN5647218)

Target: NFIA (Nuclear Factor I/A (NFIA))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NFIA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-NFIA Antikörper

Bindungsspezifität: AA 180-224

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 180-224 (AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) from the human protein were used as the immunogen for the NFIA antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-3 μg/10^6 cells

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the NFIA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu NFIA

Target: NFIA (Nuclear Factor I/A (NFIA))

Andere Bezeichnung: NFIA

Hintergrund: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.

UniProt: Q12857