Myoglobin Antikörper (AA 3-35)

Produktnummer ABIN5647210

Der Kaninchen Polyklonal Anti-Myoglobin-Antikörper wurde für WB validiert. Er ist geeignet, Myoglobin in Proben von Human zu detektieren.

Kurzübersicht für Myoglobin Antikörper (AA 3-35) (ABIN5647210)

Target: Myoglobin (MB)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Myoglobin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Myoglobin Antikörper

Bindungsspezifität: AA 3-35

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 3-35 (LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFK) were used as the immunogen for the Myoglobin antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Myoglobin antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Myoglobin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Myoglobin

Target: Myoglobin (MB)

Andere Bezeichnung: Myoglobin

Hintergrund: Myoglobin (MB) also known as PVALB, is a single-chain globular protein of 153 or 154 amino acids, containing a heme (iron-containing porphyrin) prosthetic group in the center around which the remaining apoprotein folds. It is a member of the globin superfamily and is expressed in skeletal and cardiac muscles. This gene is mapped to chromosome 22q11-q13. Myoglobin is released from damaged muscle tissue (rhabdomyolysis), which has very high concentrations of myoglobin. The released myoglobin is filtered by the kidneys but is toxic to the renal tubular epithelium and so may cause acute renal failure.

UniProt: P02144

Pathways: Brown Fat Cell Differentiation