MC3R Antikörper (AA 91-121)

Produktnummer ABIN5647192

Der Kaninchen Polyklonal anti-MC3R Antikörper wird verwendet zum Nachweis von MC3R in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für MC3R Antikörper (AA 91-121) (ABIN5647192)

Target: MC3R (Melanocortin 3 Receptor (MC3R))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MC3R Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MC3R Antikörper

Bindungsspezifität: AA 91-121

Verwendungszweck: MC3 Receptor Antibody

Sequenz: NALETIMIAI VHSDYLTFED QFIQHMDNIF D

Aufreinigung: Antigen affinity

Immunogen: Amino acids 91-121 (NALETIMIAIVHSDYLTFEDQFIQHMDNIFD) from the human protein were used as the immunogen for the MC3 Receptor antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the MC3 Receptor antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the MC3 Receptor antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu MC3R

Target: MC3R (Melanocortin 3 Receptor (MC3R))

Andere Bezeichnung: MC3 Receptor

Hintergrund: Melanocortin receptor 3 is a protein that in humans is encoded by the MC3R gene. It is mapped to 20q13.2. This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.

UniProt: P41968

Pathways: cAMP Metabolic Process