XPO5 Antikörper (AA 2-43)

Produktnummer ABIN5647153

Produktdetails anti-XPO5 Antikörper

Target: XPO5 (Exportin 5 (XPO5))

Bindungsspezifität: AA 2-43

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XPO5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 2-43 (AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK) were used as the immunogen for the Exportin-5 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Exportin-5 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Exportin-5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu XPO5

Target: XPO5 (Exportin 5 (XPO5))

Andere Bezeichnung: Exportin-5 (XPO5 Produkte)

Synonyme: exp5 antikoerper, CG12234 antikoerper, Dmel\\CG12234 antikoerper, Exp-5 antikoerper, Exp5 antikoerper, RanBP21 antikoerper, dmExp5 antikoerper, 2410004H11Rik antikoerper, 2700038C24Rik antikoerper, AI648907 antikoerper, AW549301 antikoerper, RanBp21 antikoerper, mKIAA1291 antikoerper, exportin-5 antikoerper, ranbp21 antikoerper, DDBDRAFT_0185980 antikoerper, DDBDRAFT_0237583 antikoerper, DDB_0185980 antikoerper, DDB_0237583 antikoerper, XPO5 antikoerper, exportin 5 antikoerper, CG12234 gene product from transcript CG12234-RB antikoerper, armadillo-like helical domain-containing protein antikoerper, XPO5 antikoerper, Ranbp21 antikoerper, Xpo5 antikoerper, xpo5 antikoerper

Hintergrund: Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.

UniProt: Q9HAV4

Pathways: Regulatorische RNA Pathways, Protein targeting to Nucleus