XPO5 Antikörper (AA 2-43)

Produktnummer ABIN5647153

Der Kaninchen Polyklonal Anti-XPO5-Antikörper wurde für WB validiert. Er ist geeignet, XPO5 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für XPO5 Antikörper (AA 2-43) (ABIN5647153)

Target: XPO5 (Exportin 5 (XPO5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XPO5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-XPO5 Antikörper

Bindungsspezifität: AA 2-43

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 2-43 (AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK) were used as the immunogen for the Exportin-5 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Exportin-5 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Exportin-5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu XPO5

Target: XPO5 (Exportin 5 (XPO5))

Andere Bezeichnung: Exportin-5

Hintergrund: Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.

UniProt: Q9HAV4

Pathways: Regulatorische RNA Pathways, Protein targeting to Nucleus