HOXB1 Antikörper (AA 176-220)

Produktnummer ABIN5647148

Der Kaninchen Polyklonal anti-HOXB1 Antikörper (ABIN5647148) detektiert spezifisch HOXB1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für HOXB1 Antikörper (AA 176-220) (ABIN5647148)

Target: HOXB1 (Homeobox B1 (HOXB1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HOXB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HOXB1 Antikörper

Bindungsspezifität: AA 176-220

Verwendungszweck: HOXB1 Antibody (C-Terminal Region)

Sequenz: TARTFDWMKV KRNPPKTAKV SEPGLGSPSG LRTNFTTRQL TELEK

Aufreinigung: Antigen affinity

Immunogen: Amino acids 176-220 (TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK) were used as the immunogen for the HOXB1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HOXB1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the HOXB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu HOXB1

Target: HOXB1 (Homeobox B1 (HOXB1))

Andere Bezeichnung: HOXB1

Hintergrund: Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.

UniProt: P14653