HOXB1 Antikörper (AA 176-220)

Produktnummer ABIN5647148

Produktdetails anti-HOXB1 Antikörper

Target: HOXB1 (Homeobox B1 (HOXB1))

Bindungsspezifität: AA 176-220

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HOXB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 176-220 (TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK) were used as the immunogen for the HOXB1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HOXB1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the HOXB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu HOXB1

Target: HOXB1 (Homeobox B1 (HOXB1))

Andere Bezeichnung: HOXB1 (HOXB1 Produkte)

Hintergrund: Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.

UniProt: P14653