Superoxide dismutase copper chaperone Antikörper (AA 174-209)

Produktnummer ABIN5647094

Der Kaninchen Polyklonal anti-Superoxide dismutase copper chaperone Antikörper (ABIN5647094) detektiert spezifisch Superoxide dismutase copper chaperone in WB und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für Superoxide dismutase copper chaperone Antikörper (AA 174-209) (ABIN5647094)

Target: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Superoxide dismutase copper chaperone Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-Superoxide dismutase copper chaperone Antikörper

Bindungsspezifität: AA 174-209

Verwendungszweck: CCS Antibody

Sequenz: DADGRAIFRM EDEQLKVWDV IGRSLIIDEG EDDLGR

Aufreinigung: Antigen affinity

Immunogen: Amino acids 174-209 (DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR) from the human protein were used as the immunogen for the CCS antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the CCS antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the CCS antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu Superoxide dismutase copper chaperone

Target: Superoxide dismutase copper chaperone (CCS) (Copper Chaperone For Superoxide Dismutase (CCS))

Andere Bezeichnung: CCS

Hintergrund: Copper chaperone for superoxide dismutase (CCS, SOD4) is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans.

UniProt: O14618

Pathways: Transition Metal Ion Homeostasis