IFNGR1 Antikörper (AA 443-484)

Produktnummer ABIN5647067

Dieses Anti-IFNGR1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von IFNGR1 in WB und FACS. Geeignet für Human.

Kurzübersicht für IFNGR1 Antikörper (AA 443-484) (ABIN5647067)

Target: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFNGR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS)

Produktdetails anti-IFNGR1 Antikörper

Bindungsspezifität: AA 443-484

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 443-484 (QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED) from the human protein were used as the immunogen for the IFNGR1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the IFNGR1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL, FACS: 1-3 μg/10^6 cells

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the IFNGR1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu IFNGR1

Target: IFNGR1 (Interferon gamma Receptor 1 (IFNGR1))

Andere Bezeichnung: IFNGR1 / CD119

Hintergrund: Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

UniProt: P15260

Pathways: Interferon-gamma Pathway